Recombinant Human HSD17B1

Cat.No. : HSD17B1-27735TH
Product Overview : Recombinant fragment of Human HSD17B1 (aa 189-285) with N-terminal proprietary tag, 36.3 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 97 amino acids
Description : Estradiol 17-beta-dehydrogenase 1 is an enzyme that in humans is encoded by the HSD17B1 gene.
Molecular Weight : 36.300kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVF
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name HSD17B1 hydroxysteroid (17-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol HSD17B1
Synonyms HSD17B1; hydroxysteroid (17-beta) dehydrogenase 1; EDH17B2, EDHB17; estradiol 17-beta-dehydrogenase 1; Estradiol 17 beta dehydrogenase 1; HSD17; MGC138140; SDR28C1; short chain dehydrogenase/reductase family 28CE; member 1;
Gene ID 3292
mRNA Refseq NM_000413
Protein Refseq NP_000404
MIM 109684
Uniprot ID P14061
Chromosome Location 17q11-q21
Pathway Estrogen biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Steroid Biosynthesis, organism-specific biosystem;
Function catalytic activity; estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B1 Products

Required fields are marked with *

My Review for All HSD17B1 Products

Required fields are marked with *

0
cart-icon