Recombinant Human HSD3B2
Cat.No. : | HSD3B2-29345TH |
Product Overview : | Recombinant fragment of Human HSD3B2 (aa 33-122) with N-terminal proprietary tag, 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | Expressed in adrenal gland, testis and ovary. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT |
Sequence Similarities : | Belongs to the 3-beta-HSD family. |
Gene Name | HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ] |
Official Symbol | HSD3B2 |
Synonyms | HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2; |
Gene ID | 3284 |
mRNA Refseq | NM_000198 |
Protein Refseq | NP_000189 |
MIM | 613890 |
Uniprot ID | P26439 |
Chromosome Location | 1p12 |
Pathway | Androgen biosynthesis, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => |
Function | 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; isomerase activity; nucleotide binding; oxidoreductase activity; |
◆ Cell & Tissue Lysates | ||
HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *