Recombinant Human HSD3B2

Cat.No. : HSD3B2-29345TH
Product Overview : Recombinant fragment of Human HSD3B2 (aa 33-122) with N-terminal proprietary tag, 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Expressed in adrenal gland, testis and ovary.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYT
Sequence Similarities : Belongs to the 3-beta-HSD family.
Gene Name HSD3B2 hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 [ Homo sapiens ]
Official Symbol HSD3B2
Synonyms HSD3B2; hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; SDR11E2; short chain dehydrogenase/reductase family 11E; member 2;
Gene ID 3284
mRNA Refseq NM_000198
Protein Refseq NP_000189
MIM 613890
Uniprot ID P26439
Chromosome Location 1p12
Pathway Androgen biosynthesis, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone, organism-specific biosystem; C19/C18-Steroid hormone biosynthesis, pregnenolone =>
Function 3-beta-hydroxy-delta5-steroid dehydrogenase activity; 3-beta-hydroxy-delta5-steroid dehydrogenase activity; isomerase activity; nucleotide binding; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD3B2 Products

Required fields are marked with *

My Review for All HSD3B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon