Recombinant Full Length Mesocricetus Auratus 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged
Cat.No. : | RFL29167MF |
Product Overview : | Recombinant Full Length Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2(HSD3B2) Protein (Q64421) (2-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mesocricetus auratus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-373) |
Form : | Lyophilized powder |
AA Sequence : | PGWSCLVTGAGGFLGQRIIHLLVQEKDLEEVRLLDKVFRPETREEFFKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVWGIIPRQTIIDINVKGTLNLLEACVQASVPAFI YTSSIDVAGPNSYKEIVLNGHEEQQHESTWSDPYPYSKMMAEKAVLAANGSFLKNGGTLH TCALRPMYIYGEKSSILSGIMIRAIKNNGILKVTGKFSTVNPVYVSNAAWAHILAARGLQ DPKKSPNIQGQFYYISDDTPHQSYDDLNNTLSKKWGLRPDSSWRPPVALLYWLGFLLELV NFLLRPVYNYQPPFTRYLVTISNTVFTFSYKKAQRDLGYEPLVGWEEARENTSEWIGSLV EQHKGTLNTKAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HSD3B2 |
Synonyms | HSD3B2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; |
UniProt ID | Q64421 |
◆ Recombinant Proteins | ||
HSD3B2-29345TH | Recombinant Human HSD3B2 | +Inquiry |
HSD3B2-5079H | Recombinant Human HSD3B2 Protein, GST-tagged | +Inquiry |
RFL29167MF | Recombinant Full Length Mesocricetus Auratus 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 2(Hsd3B2) Protein, His-Tagged | +Inquiry |
HSD3B2-1441HFL | Recombinant Full Length Human HSD3B2 Protein, C-Flag-tagged | +Inquiry |
HSD3B2-29343TH | Recombinant Human HSD3B2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD3B2-5369HCL | Recombinant Human HSD3B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD3B2 Products
Required fields are marked with *
My Review for All HSD3B2 Products
Required fields are marked with *