"HSF4" Related Products

Expand
Expand
Expand

Recombinant Human HSF4

Cat.No.: HSF4-29388TH
Product Overview: Recombinant fragment of Human HSF4 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in heart, skeletal muscle, eye and brain, and at much lower levels in some other tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KVPALRGDDGRWRPEDLGRLLGEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSC
Sequence Similarities: Belongs to the HSF family.
Gene Name: HSF4 heat shock transcription factor 4 [ Homo sapiens ]
Official Symbol: HSF4
Synonyms: HSF4; heat shock transcription factor 4; cataract, Marner , CTM; heat shock factor protein 4;
Gene ID: 3299
mRNA Refseq: NM_001040667
Protein Refseq: NP_001035757
MIM: 602438
Uniprot ID: Q9ULV5
Chromosome Location: 16q21
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.