"HSPA1L" Related Products

Expand

Recombinant Human HSPA1L

Cat.No.: HSPA1L-27084TH
Product Overview: Recombinant full length Human HSPA1L with N terminal proprietary tag, 96.58 kDa.
Description: This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein.
Protein length: 641 amino acids
Molecular Weight: 96.580kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in spermatids.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTT PSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKF NDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQAT KDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIF DLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSST QANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVE KALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP LSLGLETAGGVMTALMKRNSTIPTKQTQIFTTYSDNQPGV LIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF DIDANGILNVTAMDKSTGKVNKITIANDKGRLSKEEIERM VLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGL KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEV D
Sequence Similarities: Belongs to the heat shock protein 70 family.
Gene Name: HSPA1L heat shock 70kDa protein 1-like [ Homo sapiens ]
Official Symbol: HSPA1L
Synonyms: HSPA1L; heat shock 70kDa protein 1-like; heat shock 70kD protein like 1; heat shock 70 kDa protein 1-like; HSP70 HOM; hum70t;
Gene ID: 3305
mRNA Refseq: NM_005527
Protein Refseq: NP_005518
MIM: 140559
Uniprot ID: P34931
Chromosome Location: 6p21.3
Pathway: Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Influenza A, organism-specific biosystem;
Function: ATP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.