Recombinant Human ID4 ID4-28078TH

Recombinant Human ID4

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ID4

Recombinant Human ID4

ID4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ID4-28078TH
Product Overview : Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag.
Description : Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al.
Protein length : 161 amino acids
Molecular Weight : 43.780kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name : ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol : ID4
Synonyms : ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27;
Gene ID : 3400
mRNA Refseq : NM_001546
Protein Refseq : NP_001537
MIM : 600581
Uniprot ID : P47928
Chromosome Location : 6p22.3
Pathway : Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : RNA polymerase II transcription factor binding; protein binding; transcription corepressor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy