Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ID4

Cat.No. : ID4-28078TH
Product Overview : Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al.
Protein length : 161 amino acids
Molecular Weight : 43.780kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name : ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol : ID4
Synonyms : ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27;
Gene ID : 3400
mRNA Refseq : NM_001546
Protein Refseq : NP_001537
MIM : 600581
Uniprot ID : P47928
Chromosome Location : 6p22.3
Pathway : Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : RNA polymerase II transcription factor binding; protein binding; transcription corepressor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends