Recombinant Human ID4
Cat.No. : | ID4-28078TH |
Product Overview : | Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 161 amino acids |
Description : | Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al. |
Molecular Weight : | 43.780kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ] |
Official Symbol | ID4 |
Synonyms | ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27; |
Gene ID | 3400 |
mRNA Refseq | NM_001546 |
Protein Refseq | NP_001537 |
MIM | 600581 |
Uniprot ID | P47928 |
Chromosome Location | 6p22.3 |
Pathway | Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | RNA polymerase II transcription factor binding; protein binding; transcription corepressor activity; |
◆ Recombinant Proteins | ||
ID4-28078TH | Recombinant Human ID4 | +Inquiry |
ID4-3700Z | Recombinant Zebrafish ID4 | +Inquiry |
ID4-14045H | Recombinant Human ID4, His-tagged | +Inquiry |
Id4-1210M | Recombinant Mouse Id4 Protein, MYC/DDK-tagged | +Inquiry |
ID4-28592TH | Recombinant Human ID4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ID4-5309HCL | Recombinant Human ID4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ID4 Products
Required fields are marked with *
My Review for All ID4 Products
Required fields are marked with *
0
Inquiry Basket