Recombinant Human ID4

Cat.No. : ID4-28078TH
Product Overview : Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 161 amino acids
Description : Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al.
Molecular Weight : 43.780kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol ID4
Synonyms ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27;
Gene ID 3400
mRNA Refseq NM_001546
Protein Refseq NP_001537
MIM 600581
Uniprot ID P47928
Chromosome Location 6p22.3
Pathway Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function RNA polymerase II transcription factor binding; protein binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ID4 Products

Required fields are marked with *

My Review for All ID4 Products

Required fields are marked with *

0
cart-icon
0
compare icon