"IFI16" Related Products

Expand
Expand

Recombinant Human IFI16

Cat.No.: IFI16-26947TH
Product Overview: Recombinant fragment corresponding to amino acids 630-729 of Human IFI16, with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH17059; Q16666 isoform 2
Description: This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Gene Name: IFI16 interferon, gamma-inducible protein 16 [ Homo sapiens ]
Official Symbol: IFI16
Synonyms: IFI16; interferon, gamma-inducible protein 16; gamma-interferon-inducible protein 16; IFNGIP1; PYHIN2;
Gene ID: 3428
mRNA Refseq: NM_001206567
Protein Refseq: NP_001193496
MIM: 147586
Uniprot ID: Q16666
Chromosome Location: 1q22
Pathway: Id Signaling Pathway, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem;
Function: DNA binding; double-stranded DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.