Recombinant Human IFI16

Cat.No. : IFI16-26947TH
Product Overview : Recombinant fragment corresponding to amino acids 630-729 of Human IFI16, with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH17059; Q16666 isoform 2
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Gene Name IFI16 interferon, gamma-inducible protein 16 [ Homo sapiens ]
Official Symbol IFI16
Synonyms IFI16; interferon, gamma-inducible protein 16; gamma-interferon-inducible protein 16; IFNGIP1; PYHIN2;
Gene ID 3428
mRNA Refseq NM_001206567
Protein Refseq NP_001193496
MIM 147586
Uniprot ID Q16666
Chromosome Location 1q22
Pathway Id Signaling Pathway, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem;
Function DNA binding; double-stranded DNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFI16 Products

Required fields are marked with *

My Review for All IFI16 Products

Required fields are marked with *

0
cart-icon