Recombinant Human IFI16
| Cat.No. : | IFI16-26947TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 630-729 of Human IFI16, with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. AAH17059; Q16666 isoform 2 |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF |
| Gene Name | IFI16 interferon, gamma-inducible protein 16 [ Homo sapiens ] |
| Official Symbol | IFI16 |
| Synonyms | IFI16; interferon, gamma-inducible protein 16; gamma-interferon-inducible protein 16; IFNGIP1; PYHIN2; |
| Gene ID | 3428 |
| mRNA Refseq | NM_001206567 |
| Protein Refseq | NP_001193496 |
| MIM | 147586 |
| Uniprot ID | Q16666 |
| Chromosome Location | 1q22 |
| Pathway | Id Signaling Pathway, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem; |
| Function | DNA binding; double-stranded DNA binding; protein binding; |
| ◆ Recombinant Proteins | ||
| IFI16-2197R | Recombinant Rhesus monkey IFI16 Protein, His-tagged | +Inquiry |
| IFI16-26947TH | Recombinant Human IFI16 | +Inquiry |
| IFI16-1141H | Recombinant Human IFI16 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFI16-14060H | Recombinant Human IFI16, GST-tagged | +Inquiry |
| IFI16-190HFL | Recombinant Full Length Human IFI16 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFI16-5297HCL | Recombinant Human IFI16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFI16 Products
Required fields are marked with *
My Review for All IFI16 Products
Required fields are marked with *
