Recombinant Human IFI35 IFI35-26948TH

Recombinant Human IFI35

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IFI35

Recombinant Human IFI35

IFI35 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IFI35-26948TH
Product Overview : Recombinant full length Human IFI35 with N-terminal proprietary tag. Predicted MW 57.75kDa.
Protein length : 288 amino acids
Molecular Weight : 57.750kDa inclusive of tags
Source : Wheat germ
Tissue specificity : In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDK VPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGS ALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM VTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIF FGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNI PDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGL AVFTSESG
Sequence Similarities : Belongs to the NMI family.
Gene Name : IFI35 interferon-induced protein 35 [ Homo sapiens ]
Official Symbol : IFI35
Synonyms : IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35;
Gene ID : 3430
mRNA Refseq : NM_005533
Protein Refseq : NP_005524
MIM : 600735
Uniprot ID : P80217
Chromosome Location : 17q21
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, organism-specific biosystem;
Function : protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy