"IFIH1" Related Products

Expand
Expand

Recombinant Human IFIH1

Cat.No.: IFIH1-28633TH
Product Overview: Recombinant fragment corresponding to amino acids 928-1023 of Human MDA5 with a proprietary tag; Predicted MWt 36.19 including tag.
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.
Molecular Weight: 36.190kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed, at a low level. Expression is detected at slightly highest levels in placenta, pancreas and spleen and at barely levels in detectable brain, testis and lung.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD
Sequence Similarities: Belongs to the helicase family.Contains 2 CARD domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name: IFIH1 interferon induced with helicase C domain 1 [ Homo sapiens ]
Official Symbol: IFIH1
Synonyms: IFIH1; interferon induced with helicase C domain 1; interferon-induced helicase C domain-containing protein 1; helicard; Hlcd; IDDM19; MDA 5; MDA5;
Gene ID: 64135
mRNA Refseq: NM_022168
Protein Refseq: NP_071451
MIM: 606951
Uniprot ID: Q9BYX4
Chromosome Location: 2q24.2
Pathway: Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem;
Function: ATP binding; DNA binding; double-stranded RNA binding; helicase activity; hydrolase activity, acting on acid anhydrides;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.