Recombinant Human IFNA1 IFNA1-29806TH

Recombinant Human IFNA1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IFNA1

Recombinant Human IFNA1

IFNA1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IFNA1-29806TH
Product Overview : Highly pure (>98%) recombinant human interferon alpha.
Description : The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted.
Source : CHO
Form : Liquid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human IFN-alpha is a 19.2 kDa protein containing 165 amino acid residues:CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGN QFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLD KFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTN LQESLRSKE
Sequence Similarities : Belongs to the alpha/beta interferon family.
Gene Name : IFNA1 interferon, alpha 1 [ Homo sapiens ]
Official Symbol : IFNA1
Synonyms : IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b;
Gene ID : 3439
mRNA Refseq : NM_024013
Protein Refseq : NP_076918
MIM : 147660
Uniprot ID : P01562
Chromosome Location : 9p22
Pathway : Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy