"IFNA1" Related Products

Expand
Expand

Recombinant Human IFNA1

Cat.No.: IFNA1-29806TH
Product Overview: Highly pure (>98%) recombinant human interferon alpha.
Description: The protein encoded by this gene is produced by macrophages and has antiviral activity. This gene is intronless and the encoded protein is secreted.
Source: CHO
Form: Liquid
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human IFN-alpha is a 19.2 kDa protein containing 165 amino acid residues:CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGN QFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLD KFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTN LQESLRSKE
Sequence Similarities: Belongs to the alpha/beta interferon family.
Gene Name: IFNA1 interferon, alpha 1 [ Homo sapiens ]
Official Symbol: IFNA1
Synonyms: IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b;
Gene ID: 3439
mRNA Refseq: NM_024013
Protein Refseq: NP_076918
MIM: 147660
Uniprot ID: P01562
Chromosome Location: 9p22
Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.