"IL3RA" Related Products

Recombinant Human IL3RA, Fc-tagged

Cat.No.: IL3RA-29795TH
Product Overview: Recombinant fragment, corresponding to amino acids 19-302 of Human IL3RA fused to the Fc region of human IgG1 expressed in modified human 293 cells, 533 amino acids, Predicted MWt 60.6 kDa.
Description: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y.
Conjugation: Fc
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADY SMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILF PENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADV QYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISR LSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTP QRFECDQEEGANTRGGRVDGIQWIPKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 5 subfamily.
Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
Official Symbol: IL3RA
Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123;
Gene ID: 3563
mRNA Refseq: NM_002183
Protein Refseq: NP_002174
MIM: 308385
Uniprot ID: P26951
Chromosome Location: Xp22.3 and Yp13.3
Pathway: Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: interleukin-3 receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.