"INPP5B" Related Products

Recombinant Human INPP5B

Cat.No.: INPP5B-27623TH
Product Overview: Recombinant full length Human INPP5B with N terminal proprietary tag. Predicted MW 108.35 kDa.
Description: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein length: 748 amino acids
Molecular Weight: 108.350kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Platelets.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVR YRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFT LEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPR GCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRG QDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQK FGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPK ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEE EWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAY ISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHD VILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKI QVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGV RVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQ NVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN ANPSRGFLLPDSDVEIDLELFVNKTTATKLNSGEDKIEDI LVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILD LPLETISELLAYLAAYCFETQLVTKSLI
Sequence Similarities: Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type II family.Contains 1 Rho-GAP domain.
Gene Name: INPP5B inositol polyphosphate-5-phosphatase, 75kDa [ Homo sapiens ]
Official Symbol: INPP5B
Synonyms: INPP5B; inositol polyphosphate-5-phosphatase, 75kDa; inositol polyphosphate 5 phosphatase, 75kD; type II inositol-1,4,5-trisphosphate 5-phosphatase;
Gene ID: 3633
mRNA Refseq: NM_005540
Protein Refseq: NP_005531
MIM: 147264
Uniprot ID: P32019
Chromosome Location: 1p34
Pathway: 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; 3-phosphoinositide degradation, conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem;
Function: hydrolase activity; inositol-polyphosphate 5-phosphatase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.