Recombinant Human INPP5B
Cat.No. : | INPP5B-27623TH |
Product Overview : | Recombinant full length Human INPP5B with N terminal proprietary tag. Predicted MW 108.35 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Protein length : | 748 amino acids |
Molecular Weight : | 108.350kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Platelets. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVR YRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFT LEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPR GCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRG QDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQK FGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPK ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEE EWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAY ISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHD VILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKI QVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGV RVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQ NVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN ANPSRGFLLPDSDVEIDLELFVNKTTATKLNSGEDKIEDI LVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILD LPLETISELLAYLAAYCFETQLVTKSLI |
Sequence Similarities : | Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type II family.Contains 1 Rho-GAP domain. |
Gene Name : | INPP5B inositol polyphosphate-5-phosphatase, 75kDa [ Homo sapiens ] |
Official Symbol : | INPP5B |
Synonyms : | INPP5B; inositol polyphosphate-5-phosphatase, 75kDa; inositol polyphosphate 5 phosphatase, 75kD; type II inositol-1,4,5-trisphosphate 5-phosphatase; |
Gene ID : | 3633 |
mRNA Refseq : | NM_005540 |
Protein Refseq : | NP_005531 |
MIM : | 147264 |
Uniprot ID : | P32019 |
Chromosome Location : | 1p34 |
Pathway : | 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; 3-phosphoinositide degradation, conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; |
Function : | hydrolase activity; inositol-polyphosphate 5-phosphatase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
INPP5B-5106H | Recombinant Human INPP5B Protein, GST-tagged | +Inquiry |
INPP5B-4556M | Recombinant Mouse INPP5B Protein, His (Fc)-Avi-tagged | +Inquiry |
INPP5B-8226M | Recombinant Mouse INPP5B Protein | +Inquiry |
◆ Lysates | ||
INPP5B-861HCL | Recombinant Human INPP5B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionINPP5B is primarily located in the cytoplasm, where it functions to regulate inositol phosphate levels within the cell.
The activity of INPP5B can be regulated through post-translational modifications and interactions with other proteins.
INPP5B regulates cellular signaling by controlling the levels of inositol phosphates, which are essential secondary messengers in various cellular pathways.
INPP5B is a subject of research in cancer therapy, as its modulation may affect the behavior of cancer cells.
INPP5B is an enzyme involved in the dephosphorylation of inositol phosphates, specifically in the conversion of inositol 1,4,5-trisphosphate (IP3) to inositol 1,4-bisphosphate.
INPP5B is involved in regulating processes such as cell growth, proliferation, and cytoskeletal dynamics through its influence on inositol phosphate signaling.
Dysregulation of INPP5B can impact various cellular functions and has been associated with conditions like cancer, as it can alter signaling pathways that control cell growth and survival.
Customer Reviews (3)
Write a reviewWe found the product's straightforward protocols highly conducive to seamless integration into our lab work.
Clear and concise instructions simplified the application of the product, reducing the learning curve.
We appreciated the product's efficiency in achieving target protein upregulation with minimal time investment.
Ask a Question for All INPP5B Products
Required fields are marked with *
My Review for All INPP5B Products
Required fields are marked with *
Inquiry Basket