Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human INPP5B

Cat.No. : INPP5B-27623TH
Product Overview : Recombinant full length Human INPP5B with N terminal proprietary tag. Predicted MW 108.35 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). This gene encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Protein length : 748 amino acids
Molecular Weight : 108.350kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Platelets.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVR YRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFT LEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPR GCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRG QDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQK FGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPK ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEE EWFKAVSEGLHPDAKYAKVKLIRLVGIMLLLYVKQEHAAY ISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHD VILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKI QVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGV RVVNDELYRKTLEEIVRSLDKMENANIPSVSLSKREFCFQ NVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN ANPSRGFLLPDSDVEIDLELFVNKTTATKLNSGEDKIEDI LVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILD LPLETISELLAYLAAYCFETQLVTKSLI
Sequence Similarities : Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type II family.Contains 1 Rho-GAP domain.
Gene Name : INPP5B inositol polyphosphate-5-phosphatase, 75kDa [ Homo sapiens ]
Official Symbol : INPP5B
Synonyms : INPP5B; inositol polyphosphate-5-phosphatase, 75kDa; inositol polyphosphate 5 phosphatase, 75kD; type II inositol-1,4,5-trisphosphate 5-phosphatase;
Gene ID : 3633
mRNA Refseq : NM_005540
Protein Refseq : NP_005531
MIM : 147264
Uniprot ID : P32019
Chromosome Location : 1p34
Pathway : 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; 3-phosphoinositide degradation, conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem;
Function : hydrolase activity; inositol-polyphosphate 5-phosphatase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the subcellular localization of INPP5B? 10/11/2022

INPP5B is primarily located in the cytoplasm, where it functions to regulate inositol phosphate levels within the cell.

How is INPP5B activity regulated? 09/29/2022

The activity of INPP5B can be regulated through post-translational modifications and interactions with other proteins.

What is the role of INPP5B in cellular signaling? 03/28/2022

INPP5B regulates cellular signaling by controlling the levels of inositol phosphates, which are essential secondary messengers in various cellular pathways.

Is there any research on INPP5B as a therapeutic target? 12/01/2021

INPP5B is a subject of research in cancer therapy, as its modulation may affect the behavior of cancer cells.

What is INPP5B? 07/06/2018

INPP5B is an enzyme involved in the dephosphorylation of inositol phosphates, specifically in the conversion of inositol 1,4,5-trisphosphate (IP3) to inositol 1,4-bisphosphate.

In which cellular processes does INPP5B play a role? 01/19/2016

INPP5B is involved in regulating processes such as cell growth, proliferation, and cytoskeletal dynamics through its influence on inositol phosphate signaling.

What are the implications of INPP5B dysregulation? 01/18/2016

Dysregulation of INPP5B can impact various cellular functions and has been associated with conditions like cancer, as it can alter signaling pathways that control cell growth and survival.

Customer Reviews (3)

Write a review
Reviews
02/15/2020

    We found the product's straightforward protocols highly conducive to seamless integration into our lab work.

    10/17/2017

      Clear and concise instructions simplified the application of the product, reducing the learning curve.

      06/18/2017

        We appreciated the product's efficiency in achieving target protein upregulation with minimal time investment.

        Ask a Question for All INPP5B Products

        Required fields are marked with *

        My Review for All INPP5B Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends