Recombinant Human KCNA1
Cat.No. : | KCNA1-29199TH |
Product Overview : | Recombinant fragment corresponding to amino acids 410-495 of Human Kv1.1 potassium channel with an N terminal proprietary tag; Predicted MWt 35.09 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 86 amino acids |
Description : | This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). |
Molecular Weight : | 35.090kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV |
Sequence Similarities : | Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily. |
Gene Name | KCNA1 potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) [ Homo sapiens ] |
Official Symbol | KCNA1 |
Synonyms | KCNA1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); AEMK; potassium voltage-gated channel subfamily A member 1; HUK1; Kv1.1; MBK1; RBK1; |
Gene ID | 3736 |
mRNA Refseq | NM_000217 |
Protein Refseq | NP_000208 |
MIM | 176260 |
Uniprot ID | Q09470 |
Chromosome Location | 12p13 |
Pathway | Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem; |
Function | delayed rectifier potassium channel activity; potassium channel activity; potassium ion transmembrane transporter activity; voltage-gated ion channel activity; |
◆ Cell & Tissue Lysates | ||
KCNA1-5079HCL | Recombinant Human KCNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNA1 Products
Required fields are marked with *
My Review for All KCNA1 Products
Required fields are marked with *