"KCNA1" Related Products

Recombinant Human KCNA1

Cat.No.: KCNA1-29199TH
Product Overview: Recombinant fragment corresponding to amino acids 410-495 of Human Kv1.1 potassium channel with an N terminal proprietary tag; Predicted MWt 35.09 kDa.
Description: This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK).
Protein length: 86 amino acids
Molecular Weight: 35.090kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
Sequence Similarities: Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily.
Gene Name: KCNA1 potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) [ Homo sapiens ]
Official Symbol: KCNA1
Synonyms: KCNA1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); AEMK; potassium voltage-gated channel subfamily A member 1; HUK1; Kv1.1; MBK1; RBK1;
Gene ID: 3736
mRNA Refseq: NM_000217
Protein Refseq: NP_000208
MIM: 176260
Uniprot ID: Q09470
Chromosome Location: 12p13
Pathway: Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem;
Function: delayed rectifier potassium channel activity; potassium channel activity; potassium ion transmembrane transporter activity; voltage-gated ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.