"KCNK1" Related Products

Recombinant Human KCNK1

Cat.No.: KCNK1-28456TH
Product Overview: Recombinant fragment of Human KCNK1 protein with an N terminal proprietary tag. Predicted MW 33.55 kDa.
Description: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
Protein length: 72 amino acids
Molecular Weight: 33.550kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Sequence Similarities: Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Gene Name: KCNK1 potassium channel, subfamily K, member 1 [ Homo sapiens ]
Official Symbol: KCNK1
Synonyms: KCNK1; potassium channel, subfamily K, member 1; potassium channel subfamily K member 1; DPK; K2p1.1; TWIK 1;
Gene ID: 3775
mRNA Refseq: NM_002245
Protein Refseq: NP_002236
MIM: 601745
Uniprot ID: O00180
Chromosome Location: 1q42-q43
Pathway: Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK), organism-specific biosystem; Tandem pore domain potassium channels, organism-specific biosystem;
Function: inward rectifier potassium channel activity; ion channel activity; potassium channel activity; voltage-gated ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.