"LAIR2" Related Products

Expand

Recombinant Human LAIR2

Cat.No. : LAIR2-29000TH
Product Overview : Recombinant full length Human LAIR2 with N terminal proprietary tag; Predicted MW 42.79 kDa.
Description : The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.
Protein length : 152 amino acids
Molecular Weight : 42.790kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIS PGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVFRLGPS ESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name : LAIR2 leukocyte-associated immunoglobulin-like receptor 2 [ Homo sapiens ]
Official Symbol : LAIR2
Synonyms : LAIR2; leukocyte-associated immunoglobulin-like receptor 2; leukocyte associated Ig like receptor 2; CD306;
Gene ID : 3904
mRNA Refseq : NM_002288
Protein Refseq : NP_002279
MIM : 602993
Uniprot ID : Q6ISS4
Chromosome Location : 19q13.4
Function : receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.