Recombinant Human LAIR2

• Cat.No.: LAIR2-29000TH
• Product Overview: Recombinant full length Human LAIR2 with N terminal proprietary tag; Predicted MW 42.79 kDa.

Specification

• Description: The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 152 amino acids
• Molecular Weight: 42.790kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVIS PGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVFRLGPS ESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLV KESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
• Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Gene Information

• Gene Name: LAIR2 leukocyte-associated immunoglobulin-like receptor 2 [ Homo sapiens ]
• Official Symbol: LAIR2
• Synonyms: LAIR2; leukocyte-associated immunoglobulin-like receptor 2; leukocyte associated Ig like receptor 2; CD306
• Gene ID: 3904
• mRNA Refseq: NM_002288
• Protein Refseq: NP_002279
• MIM: 602993
• Uniprot ID: Q6ISS4
• Chromosome Location: 19q13.4
• Function: receptor activity