"LAP3" Related Products

Expand

Recombinant Human LAP3, His-tagged

Cat.No.: LAP3-27947TH
Product Overview: Recombinant fragment, corresponding to amino acids 78-468 of Human LAP3 with an N terminal His tag. Predicted mwt: 43 kDa;
Description: LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. It catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. Reduced enzymatic activity of LAP3 may cause hypertension.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 45 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEG KENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGA VLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFA SGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVH IRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPN ANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGA ATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDV VRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIL NAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIET GDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAA AFL
Gene Name: LAP3 leucine aminopeptidase 3 [ Homo sapiens ]
Official Symbol: LAP3
Synonyms: LAP3; leucine aminopeptidase 3; PEPS, peptidase S; cytosol aminopeptidase; LAP; LAPEP;
Gene ID: 51056
mRNA Refseq: NM_015907
Protein Refseq: NP_056991
MIM: 170250
Uniprot ID: P28838
Chromosome Location: 4p15.33
Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem; Glutathione metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: aminopeptidase activity; magnesium ion binding; manganese ion binding; metalloexopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.