"LGALS14" Related Products

Recombinant Human LGALS14, His-tagged

Cat.No.: LGALS14-26800TH
Product Overview: Recombinant full length Human LGALS14 with an N terminal His tag ; Predicted MWt: 18.5 kDa;
Description: This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Protein length: 139 amino acids
Conjugation: HIS
Molecular Weight: 18.500kDa
Source: E. coli
Tissue specificity: Highly expressed in placenta.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
Sequence Similarities: Contains 1 galectin domain.
Gene Name: LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ]
Official Symbol: LGALS14
Synonyms: LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13;
Gene ID: 56891
mRNA Refseq: NM_203471
Protein Refseq: NP_982297
MIM: 607260
Uniprot ID: Q8TCE9
Chromosome Location: 19q13
Function: sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.