Recombinant Human LGALS14, His-tagged

Cat.No. : LGALS14-26800TH
Product Overview : Recombinant full length Human LGALS14 with an N terminal His tag ; Predicted MWt: 18.5 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 139 amino acids
Description : This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Conjugation : HIS
Molecular Weight : 18.500kDa
Tissue specificity : Highly expressed in placenta.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD
Sequence Similarities : Contains 1 galectin domain.
Gene Name LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ]
Official Symbol LGALS14
Synonyms LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13;
Gene ID 56891
mRNA Refseq NM_203471
Protein Refseq NP_982297
MIM 607260
Uniprot ID Q8TCE9
Chromosome Location 19q13
Function sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS14 Products

Required fields are marked with *

My Review for All LGALS14 Products

Required fields are marked with *

0
cart-icon
0
compare icon