Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALS14-3865H |
Product Overview : | LGALS14 MS Standard C13 and N15-labeled recombinant protein (NP_064514) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Molecular Mass : | 16.1 kDa |
AA Sequence : | MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALS14 galectin 14 [ Homo sapiens (human) ] |
Official Symbol | LGALS14 |
Synonyms | LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13; gal-14; galectin-14; Charcot-Leyden crystal protein 2; placental protein 13-like protein; MGC22235; |
Gene ID | 56891 |
mRNA Refseq | NM_020129 |
Protein Refseq | NP_064514 |
MIM | 607260 |
UniProt ID | Q8TCE9 |
◆ Recombinant Proteins | ||
LGALS14-2853H | Recombinant Human LGALS14, His-tagged | +Inquiry |
LGALS14-258H | Recombinant Human LGALS14 Protein (Ser2-Asp139), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS14-26800TH | Recombinant Human LGALS14, His-tagged | +Inquiry |
LGALS14-3865H | Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALS14-3579H | Recombinant Human LGALS14 Protein (Met1-Asp139), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS14 Products
Required fields are marked with *
My Review for All LGALS14 Products
Required fields are marked with *