Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LGALS14-3865H
Product Overview : LGALS14 MS Standard C13 and N15-labeled recombinant protein (NP_064514) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Mass : 16.1 kDa
AA Sequence : MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LGALS14 galectin 14 [ Homo sapiens (human) ]
Official Symbol LGALS14
Synonyms LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13; gal-14; galectin-14; Charcot-Leyden crystal protein 2; placental protein 13-like protein; MGC22235;
Gene ID 56891
mRNA Refseq NM_020129
Protein Refseq NP_064514
MIM 607260
UniProt ID Q8TCE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS14 Products

Required fields are marked with *

My Review for All LGALS14 Products

Required fields are marked with *

0
cart-icon
0
compare icon