Recombinant Human LGALS14, His-tagged
Cat.No. : | LGALS14-26800TH |
Product Overview : | Recombinant full length Human LGALS14 with an N terminal His tag ; Predicted MWt: 18.5 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139 amino acids |
Description : | This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Conjugation : | HIS |
Molecular Weight : | 18.500kDa |
Tissue specificity : | Highly expressed in placenta. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD |
Sequence Similarities : | Contains 1 galectin domain. |
Gene Name | LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ] |
Official Symbol | LGALS14 |
Synonyms | LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13; |
Gene ID | 56891 |
mRNA Refseq | NM_203471 |
Protein Refseq | NP_982297 |
MIM | 607260 |
Uniprot ID | Q8TCE9 |
Chromosome Location | 19q13 |
Function | sugar binding; |
◆ Recombinant Proteins | ||
LGALS14-534H | Recombinant Human LGALS14 Protein, MYC/DDK-tagged | +Inquiry |
LGALS14-3579H | Recombinant Human LGALS14 Protein (Met1-Asp139), N-His tagged | +Inquiry |
LGALS14-3865H | Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGALS14-258H | Recombinant Human LGALS14 Protein (Ser2-Asp139), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS14-2853H | Recombinant Human LGALS14, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS14 Products
Required fields are marked with *
My Review for All LGALS14 Products
Required fields are marked with *