Recombinant Human LGALS14, His-tagged
| Cat.No. : | LGALS14-26800TH |
| Product Overview : | Recombinant full length Human LGALS14 with an N terminal His tag ; Predicted MWt: 18.5 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 139 amino acids |
| Description : | This gene is predominantly expressed in placenta. The encoded protein belongs to the galectin (galaptin/S-lectin) family. The members of galectin family contain one or two carbohydrate recognition domains, which can bind beta-galactoside. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Conjugation : | HIS |
| Molecular Weight : | 18.500kDa |
| Tissue specificity : | Highly expressed in placenta. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISD |
| Sequence Similarities : | Contains 1 galectin domain. |
| Gene Name | LGALS14 lectin, galactoside-binding, soluble, 14 [ Homo sapiens ] |
| Official Symbol | LGALS14 |
| Synonyms | LGALS14; lectin, galactoside-binding, soluble, 14; placental protein 13-like; CLC2; PPL13; |
| Gene ID | 56891 |
| mRNA Refseq | NM_203471 |
| Protein Refseq | NP_982297 |
| MIM | 607260 |
| Uniprot ID | Q8TCE9 |
| Chromosome Location | 19q13 |
| Function | sugar binding; |
| ◆ Recombinant Proteins | ||
| LGALS14-446H | Recombinant Human LGALS14 Protein, His-tagged | +Inquiry |
| LGALS14-534H | Recombinant Human LGALS14 Protein, MYC/DDK-tagged | +Inquiry |
| LGALS14-3579H | Recombinant Human LGALS14 Protein (Met1-Asp139), N-His tagged | +Inquiry |
| LGALS14-26800TH | Recombinant Human LGALS14, His-tagged | +Inquiry |
| LGALS14-3865H | Recombinant Human LGALS14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS14 Products
Required fields are marked with *
My Review for All LGALS14 Products
Required fields are marked with *
