"LYPLA2" Related Products

Expand
Expand

Recombinant Human LYPLA2, His-tagged

Cat.No.: LYPLA2-28844TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-231 of Human LYPLA2, with N terminal His tag; 231 amino acids, 30kDa.
Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 77 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDL MGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRI VLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRA FPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLR SVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPP V
Sequence Similarities: Belongs to the AB hydrolase 2 family.
Gene Name: LYPLA2 lysophospholipase II [ Homo sapiens ]
Official Symbol: LYPLA2
Synonyms: LYPLA2; lysophospholipase II; acyl-protein thioesterase 2; APT 2;
Gene ID: 11313
mRNA Refseq: NM_007260
Protein Refseq: NP_009191
Uniprot ID: O95372
Chromosome Location: 1p36.11
Pathway: Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem;
Function: hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.