Recombinant Full Length Human LYPLA2 Protein, GST-tagged

Cat.No. : LYPLA2-6242HF
Product Overview : Human LYPLA2 full-length ORF ( NP_009191.1, 1 a.a. - 231 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 231 amino acids
Description : Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq
Molecular Mass : 51.1 kDa
AA Sequence : MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYPLA2 lysophospholipase II [ Homo sapiens ]
Official Symbol LYPLA2
Synonyms LYPLA2; lysophospholipase II; acyl-protein thioesterase 2; APT 2; LPL-II; lysoPLA II; APT-2; DJ886K2.4;
Gene ID 11313
mRNA Refseq NM_007260
Protein Refseq NP_009191
MIM 616143
UniProt ID O95372

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPLA2 Products

Required fields are marked with *

My Review for All LYPLA2 Products

Required fields are marked with *

0
cart-icon