"MAFA" Related Products

Expand

Recombinant Human MAFA

Cat.No.: MAFA-28859TH
Product Overview: Recombinant fragment of Human MAFA (amino acids 222-308) with proprietary tag, predicted MW 35.20 kDa.
Description: MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al.
Protein length: 87 amino acids
Molecular Weight: 35.200kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
Sequence Similarities: Belongs to the bZIP family. Maf subfamily.Contains 1 bZIP domain.
Gene Name: MAFA v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) [ Homo sapiens ]
Official Symbol: MAFA
Synonyms: MAFA; v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian); transcription factor MafA; hMafA; RIPE3b1;
Gene ID: 389692
mRNA Refseq: NM_201589
Protein Refseq: NP_963883
MIM: 610303
Uniprot ID: Q8NHW3
Chromosome Location: 8q24.3
Pathway: Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem;
Function: DNA binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.