"MAG" Related Products

Expand
Expand
Expand

Recombinant Human MAG

Cat.No.: MAG-29106TH
Product Overview: Recombinant fragment corresponding to amino acids 119-208 of Human MAG with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
Description: The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
Gene Name: MAG myelin associated glycoprotein [ Homo sapiens ]
Official Symbol: MAG
Synonyms: MAG; myelin associated glycoprotein; GMA; myelin-associated glycoprotein; S MAG; sialic acid binding Ig like lectin 4A; SIGLEC 4A; SIGLEC4A;
Gene ID: 4099
mRNA Refseq: NM_001199216
Protein Refseq: NP_001186145
MIM: 159460
Uniprot ID: P20916
Chromosome Location: 19q13.1
Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Basigin interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem;
Function: sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.