Recombinant Human MAG

• Cat.No.: MAG-29106TH
• Product Overview: Recombinant fragment corresponding to amino acids 119-208 of Human MAG with an N terminal proprietary tag; Predicted MWt 35.53 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR

Gene Information

• Gene Name: MAG myelin associated glycoprotein [ Homo sapiens ]
• Official Symbol: MAG
• Synonyms: MAG; myelin associated glycoprotein; GMA; myelin-associated glycoprotein; S MAG; sialic acid binding Ig like lectin 4A; SIGLEC 4A; SIGLEC4A
• Gene ID: 4099
• mRNA Refseq: NM_001199216
• Protein Refseq: NP_001186145
• MIM: 159460
• Uniprot ID: P20916
• Chromosome Location: 19q13.1
• Pathway: Axonal growth inhibition (RHOA activation), organism-specific biosystem; Basigin interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem
• Function: sugar binding