Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MAP2

Cat.No. : MAP2-28460TH
Product Overview : Recombinant full length Human MAP2 with N terminal proprietary tag; Predicted MWt 77.88 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Protein length : 471 amino acids
Molecular Weight : 77.880kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEG LVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELT SADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT AALPLAAEETANLPPSPPPSPASEQTVTVEEAAGGESALA PSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSG DRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTP GSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAI LVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSK IGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRH RPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVK IDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSN VSSSGSINLLESPQLATLAEDVTAALAKQGL
Sequence Similarities : Contains 3 Tau/MAP repeats.
Gene Name : MAP2 microtubule-associated protein 2 [ Homo sapiens ]
Official Symbol : MAP2
Synonyms : MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C;
Gene ID : 4133
mRNA Refseq : NM_001039538
Protein Refseq : NP_001034627
MIM : 157130
Uniprot ID : P11137
Chromosome Location : 2q34-q35
Pathway : LKB1 signaling events, organism-specific biosystem; MAPK Cascade, organism-specific biosystem;
Function : beta-dystroglycan binding; calmodulin binding; protein binding; structural molecule activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How about the possible aspects of future research on MAP2? 10/08/2022

Future research on MAP2 may involve its mechanism of action in neurological diseases, its interaction with other proteins, etc.

What is the relationship between MAP2 and neurological disorders? 08/21/2022

MAP2 may be associated with certain neurological diseases, such as Alzheimer's disease and Parkinson's disease. However, there is still insufficient research on this aspect.

What are some of the current controversies or unresolved issues in the study of MAP2? 11/05/2021

There are still many controversial and unresolved issues in the current research on MAP2, such as its mechanism of action in neurological diseases.

How can the function of MAP2 be studied experimentally? 06/05/2021

The effects of MAP2 on neuronal structure and function, as well as its role in neurological diseases, can be studied through experimental methods such as cell culture and animal models.

How about the distribution of MAP2 in neurons? 02/22/2021

MAP2 is unevenly distributed in neurons and is mainly concentrated in axons and dendrites, with a higher density in dendrites.

How about the relationship between MAP2 and learning Xi and memory? 10/12/2020

The MAP2 may affect the process of learning Xi and memory by affecting the structure and function of neurons. However, there is insufficient research on this aspect.

Customer Reviews (3)

Write a review
Reviews
04/11/2023

    I've been using them for several years now and they've been stable and I trust this product a lot.

    02/02/2022

      It is very suitable for biological activity experiments, and the activity is good.

      05/19/2020

        It can meet the needs of daily experiments and has good expression effect.

        Ask a Question for All MAP2 Products

        Required fields are marked with *

        My Review for All MAP2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends