"MAP2" Related Products

Expand

Recombinant Human MAP2

Cat.No.: MAP2-28460TH
Product Overview: Recombinant full length Human MAP2 with N terminal proprietary tag; Predicted MWt 77.88 kDa.
Description: This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Protein length: 471 amino acids
Molecular Weight: 77.880kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEG LVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELT SADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT AALPLAAEETANLPPSPPPSPASEQTVTVEEAAGGESALA PSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSG DRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTP GSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAI LVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSK IGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRH RPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVK IDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSN VSSSGSINLLESPQLATLAEDVTAALAKQGL
Sequence Similarities: Contains 3 Tau/MAP repeats.
Gene Name: MAP2 microtubule-associated protein 2 [ Homo sapiens ]
Official Symbol: MAP2
Synonyms: MAP2; microtubule-associated protein 2; MAP2A; MAP2B; MAP2C;
Gene ID: 4133
mRNA Refseq: NM_001039538
Protein Refseq: NP_001034627
MIM: 157130
Uniprot ID: P11137
Chromosome Location: 2q34-q35
Pathway: LKB1 signaling events, organism-specific biosystem; MAPK Cascade, organism-specific biosystem;
Function: beta-dystroglycan binding; calmodulin binding; protein binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.