Recombinant Human MAPK8IP2, His-tagged

Cat.No. : MAPK8IP2-29843TH
Product Overview : Recombinant fragment, corresponding to amino acids 569-797 of Human JIP2 with an N terminal His tag. Observed mwt: 30 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 569-797 a.a.
Description : The protein encoded by this gene is closely related to MAPK8IP1/IB1/JIP-1, a scaffold protein that is involved in the c-Jun amino-terminal kinase signaling pathway. This protein is expressed in brain and pancreatic cells. It has been shown to interact with, and regulate the activity of MAPK8/JNK1, and MAP2K7/MKK7 kinases. This protein thus is thought to function as a regulator of signal transduction by protein kinase cascade in brain and pancreatic beta-cells. Alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene.
Conjugation : HIS
Tissue specificity : Expressed mainly in the brain and pancreas, including insulin-secreting cells. In the nervous system, more abundantly expressed in the cerebellum, pituitary gland, occipital lobe and the amygdala. Also expressed in fetal brain. Very low levels found in ut
Form : Lyophilised:Reconstitute with 142 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FSCLVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEA EEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGS KRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATAR KLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHF FQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVS QESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
Sequence Similarities : Belongs to the JIP scaffold family.Contains 1 PID domain.Contains 1 SH3 domain.
Gene Name MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ]
Official Symbol MAPK8IP2
Synonyms MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2;
Gene ID 23542
mRNA Refseq NM_012324
Protein Refseq NP_036456
MIM 607755
Uniprot ID Q13387
Chromosome Location 22q13.33
Pathway MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem;
Function MAP-kinase scaffold activity; beta-amyloid binding; kinesin binding; protein complex binding; protein kinase activator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK8IP2 Products

Required fields are marked with *

My Review for All MAPK8IP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon