Recombinant Human MAPK8IP2 protein, GST-tagged

Cat.No. : MAPK8IP2-301565H
Product Overview : Recombinant Human MAPK8IP2 (41-135 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr41-Lys135
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : TDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQGFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSASVEEPHK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ]
Official Symbol MAPK8IP2
Synonyms MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2; IB-2; JIP-2; islet-brain 2; islet-brain-2; JNK-interacting protein 2; homologous to mouse JIP-1; JNK MAP kinase scaffold protein 2; JNK MAP kinase scaffold protein JIP2; mitogen-activated protein kinase 8-interacting protein 2; PRKM8IPL;
Gene ID 23542
mRNA Refseq NM_012324
Protein Refseq NP_036456
MIM 607755
UniProt ID Q13387

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK8IP2 Products

Required fields are marked with *

My Review for All MAPK8IP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon