Recombinant Human MAPK8IP2 protein, GST-tagged

• Cat.No.: MAPK8IP2-301565H
• Product Overview: Recombinant Human MAPK8IP2 (41-135 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Thr41-Lys135
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: TDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQGFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSASVEEPHK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ]
• Official Symbol: MAPK8IP2
• Synonyms: MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2; IB-2; JIP-2; islet-brain 2; islet-brain-2; JNK-interacting protein 2; homologous to mouse JIP-1; JNK MAP kinase scaffold protein 2; JNK MAP kinase scaffold protein JIP2; mitogen-activated protein kinase 8-interacting protein 2; PRKM8IPL
• Gene ID: 23542
• mRNA Refseq: NM_012324
• Protein Refseq: NP_036456
• MIM: 607755
• UniProt ID: Q13387