Recombinant Human MAPK8IP2 protein, GST-tagged
Cat.No. : | MAPK8IP2-301565H |
Product Overview : | Recombinant Human MAPK8IP2 (41-135 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr41-Lys135 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | TDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQGFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPAPGPLIPSASVEEPHK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MAPK8IP2 mitogen-activated protein kinase 8 interacting protein 2 [ Homo sapiens ] |
Official Symbol | MAPK8IP2 |
Synonyms | MAPK8IP2; mitogen-activated protein kinase 8 interacting protein 2; PRKM8 interacting protein like , PRKM8IPL; C-Jun-amino-terminal kinase-interacting protein 2; IB2; islet brain 2; JIP2; JNK interacting protein 2; IB-2; JIP-2; islet-brain 2; islet-brain-2; JNK-interacting protein 2; homologous to mouse JIP-1; JNK MAP kinase scaffold protein 2; JNK MAP kinase scaffold protein JIP2; mitogen-activated protein kinase 8-interacting protein 2; PRKM8IPL; |
Gene ID | 23542 |
mRNA Refseq | NM_012324 |
Protein Refseq | NP_036456 |
MIM | 607755 |
UniProt ID | Q13387 |
◆ Recombinant Proteins | ||
Mapk8ip2-3947M | Recombinant Mouse Mapk8ip2 Protein, Myc/DDK-tagged | +Inquiry |
MAPK8IP2-384H | Recombinant Human MAPK8IP2 Protein, MYC/DDK-tagged | +Inquiry |
MAPK8IP2-6302H | Recombinant Human MAPK8IP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAPK8IP2-301565H | Recombinant Human MAPK8IP2 protein, GST-tagged | +Inquiry |
MAPK8IP2-29843TH | Recombinant Human MAPK8IP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK8IP2-402HCL | Recombinant Human MAPK8IP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK8IP2 Products
Required fields are marked with *
My Review for All MAPK8IP2 Products
Required fields are marked with *
0
Inquiry Basket