Recombinant Human MBD3, His-tagged

Cat.No. : MBD3-28525TH
Product Overview : Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 164-291 a.a.
Description : DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV
Sequence Similarities : Contains 1 MBD (methyl-CpG-binding) domain.
Gene Name MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ]
Official Symbol MBD3
Synonyms MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3;
Gene ID 53615
mRNA Refseq NM_003926
Protein Refseq NP_003917
MIM 603573
Uniprot ID O95983
Chromosome Location 19p13
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function DNA binding; chromatin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBD3 Products

Required fields are marked with *

My Review for All MBD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon