Recombinant Human MBD3, His-tagged

• Cat.No.: MBD3-28525TH
• Product Overview: Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 164-291 a.a.
• Description: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 86 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV
• Sequence Similarities: Contains 1 MBD (methyl-CpG-binding) domain.

Gene Information

• Gene Name: MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ]
• Official Symbol: MBD3
• Synonyms: MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3
• Gene ID: 53615
• mRNA Refseq: NM_003926
• Protein Refseq: NP_003917
• MIM: 603573
• Uniprot ID: O95983
• Chromosome Location: 19p13
• Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem
• Function: DNA binding; chromatin binding; protein binding