"MBD3" Related Products

Recombinant Human MBD3, His-tagged

Cat.No.: MBD3-28525TH
Product Overview: Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa.
Description: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV
Sequence Similarities: Contains 1 MBD (methyl-CpG-binding) domain.
Gene Name: MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ]
Official Symbol: MBD3
Synonyms: MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3;
Gene ID: 53615
mRNA Refseq: NM_003926
Protein Refseq: NP_003917
MIM: 603573
Uniprot ID: O95983
Chromosome Location: 19p13
Pathway: Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function: DNA binding; chromatin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.