"MKI67" Related Products

Expand

Recombinant Human MKI67, His-tagged

Cat.No.: MKI67-28648TH
Product Overview: Recombinant fragment, corresponding to amino acids 2891-3256 of Human Ki67 with N terminal His tag; 366 amino acids, 57kDa.
Description: This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 134 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGH TEELANGAADSFTSAPKQTPDSGKPLKISRRVLRAPKV EPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGGGKDGSV TGTKRLRCMPAPEEIVEELPASKKQRVAPRARGKSSEPVV IMKRSLRTSAKRIEPAEELNSNDMKTNKEEHKLQDSVP ENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRNEK KPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCL RSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAED NVCVKKIRTRSHRDSEDI
Sequence Similarities: Contains 1 FHA domain.
Gene Name: MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ]
Official Symbol: MKI67
Synonyms: MKI67; antigen identified; antigen KI-67;
Gene ID: 4288
mRNA Refseq: NM_001145966
Protein Refseq: NP_001139438
MIM: 176741
Uniprot ID: P46013
Chromosome Location: 10q26.2
Function: ATP binding; nucleotide binding; protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.