Recombinant Human MKI67 protein, His-tagged
Cat.No. : | MKI67-8543H |
Product Overview : | Recombinant Human MKI67 protein(1201-1300 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1201-1300 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ] |
Official Symbol | MKI67 |
Synonyms | MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA; |
Gene ID | 4288 |
mRNA Refseq | NM_001145966 |
Protein Refseq | NP_001139438 |
MIM | 176741 |
UniProt ID | P46013 |
◆ Recombinant Proteins | ||
MKI67-3227H | Recombinant Human MKI67 protein, His-SUMO-tagged | +Inquiry |
MKI67-1711HFL | Recombinant Full Length Human MKI67, Flag-tagged | +Inquiry |
MKI67-8544H | Recombinant Human MKI67 protein, GST-tagged | +Inquiry |
MKI67-1780R | Recombinant Rabbit MKI67 Protein, His-tagged | +Inquiry |
Mki67-1781R | Recombinant Rat Mki67 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKI67 Products
Required fields are marked with *
My Review for All MKI67 Products
Required fields are marked with *