Recombinant Human MKI67 protein, His-tagged
| Cat.No. : | MKI67-8543H |
| Product Overview : | Recombinant Human MKI67 protein(1201-1300 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1201-1300 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ] |
| Official Symbol | MKI67 |
| Synonyms | MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA; |
| Gene ID | 4288 |
| mRNA Refseq | NM_001145966 |
| Protein Refseq | NP_001139438 |
| MIM | 176741 |
| UniProt ID | P46013 |
| ◆ Recombinant Proteins | ||
| MKI67-4552H | Recombinant Human MKI67 Protein (Gly3088-Lys3235), N-His tagged | +Inquiry |
| MKI67-893H | Recombinant Human MKI67 protein, His-tagged | +Inquiry |
| MKI67-983H | Recombinant Human MKI67 protein, His-tagged | +Inquiry |
| MKI67-4555H | Recombinant Human MKI67 protein, His-tagged | +Inquiry |
| MKI67-28648TH | Recombinant Human MKI67, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKI67 Products
Required fields are marked with *
My Review for All MKI67 Products
Required fields are marked with *
