Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MKLN1

Cat.No. : MKLN1-30244TH
Product Overview : Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al.
Protein length : 103 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL
Gene Name : MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ]
Official Symbol : MKLN1
Synonyms : MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2;
Gene ID : 4289
mRNA Refseq : NM_001145354
Protein Refseq : NP_001138826
MIM : 605623
Uniprot ID : Q9UL63
Chromosome Location : 7q32

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MKLN1 Products

Required fields are marked with *

My Review for All MKLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends