Recombinant Human MKLN1
Cat.No. : | MKLN1-30244TH |
Product Overview : | Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al. |
Protein length : | 103 amino acids |
Molecular Weight : | 36.960kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL |
Gene Name : | MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ] |
Official Symbol : | MKLN1 |
Synonyms : | MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2; |
Gene ID : | 4289 |
mRNA Refseq : | NM_001145354 |
Protein Refseq : | NP_001138826 |
MIM : | 605623 |
Uniprot ID : | Q9UL63 |
Chromosome Location : | 7q32 |
Products Types
◆ Recombinant Protein | ||
MKLN1-3351R | Recombinant Rat MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MKLN1-2599R | Recombinant Rhesus Macaque MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MKLN1-5573M | Recombinant Mouse MKLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MKLN1-5364H | Recombinant Human MKLN1 Protein, GST-tagged | +Inquiry |
Mkln1-4082M | Recombinant Mouse Mkln1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
MKLN1-4304HCL | Recombinant Human MKLN1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MKLN1 Products
Required fields are marked with *
My Review for All MKLN1 Products
Required fields are marked with *
0
Inquiry Basket