"MKLN1" Related Products

Expand

Recombinant Human MKLN1

Cat.No.: MKLN1-30244TH
Product Overview: Recombinant fragment corresponding to amino acids 633-735 of Human Mkln1 with an N terminal proprietary tag; Predicted MWt 36.96 kDa inclusive of tag.
Description: Muskelin is an intracellular protein that acts as a mediator of cell spreading and cytoskeletal responses to the extracellular matrix component thrombospondin I (MIM 188060) (Adams et al.
Protein length: 103 amino acids
Molecular Weight: 36.960kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP EETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFD TLVNFFPDSMTPPKGNLVDLITL
Gene Name: MKLN1 muskelin 1, intracellular mediator containing kelch motifs [ Homo sapiens ]
Official Symbol: MKLN1
Synonyms: MKLN1; muskelin 1, intracellular mediator containing kelch motifs; muskelin; TWA2;
Gene ID: 4289
mRNA Refseq: NM_001145354
Protein Refseq: NP_001138826
MIM: 605623
Uniprot ID: Q9UL63
Chromosome Location: 7q32

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.