"MMAB" Related Products

Expand
Expand

Recombinant Human MMAB, His-tagged

Cat.No.: MMAB-27647TH
Product Overview: Recombinant full length Human MMAB with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.3 kDa.
Description: This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (Ad°Cbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
Protein length: 218 amino acids
Conjugation: HIS
Molecular Weight: 26.300kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in liver and skeletal muscle.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAESEGL
Sequence Similarities: Belongs to the Cob(I)alamin adenosyltransferase family.
Gene Name: MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ]
Official Symbol: MMAB
Synonyms: MMAB; methylmalonic aciduria (cobalamin deficiency) cblB type; methylmalonic aciduria (cobalamin deficiency) type B; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; cblB;
Gene ID: 326625
mRNA Refseq: NM_052845
Protein Refseq: NP_443077
MIM: 607568
Uniprot ID: Q96EY8
Chromosome Location: 12q24
Pathway: Metabolic pathways, organism-specific biosystem; Porphyrin and chlorophyll metabolism, organism-specific biosystem; Porphyrin and chlorophyll metabolism, conserved biosystem;
Function: ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; nucleotide binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.