Recombinant Human MOB1A
Cat.No. : | MOB1A-28178TH |
Product Overview : | Recombinant full length Human MOBK1B expressed in Saccharomyces cerevisiae; amino acids 1-216, 216 amino acids, MWt 25.1 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Tissue specificity : | Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGN LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEF CTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYID YLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLF RVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFN LIDRRELAPLQELIEKLGSKDR |
Sequence Similarities : | Belongs to the MOB1/phocein family. |
Gene Name : | MOB1A MOB kinase activator 1A [ Homo sapiens ] |
Official Symbol : | MOB1A |
Synonyms : | MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma |
Gene ID : | 55233 |
mRNA Refseq : | NM_018221 |
Protein Refseq : | NP_060691 |
MIM : | 609281 |
Uniprot ID : | Q9H8S9 |
Chromosome Location : | 2p13.1 |
Function : | metal ion binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
MOB1A-5617M | Recombinant Mouse MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Mob1a-4104M | Recombinant Mouse Mob1a Protein, Myc/DDK-tagged | +Inquiry |
MOB1A-5455H | Recombinant Human MOB1A Protein, GST-tagged | +Inquiry |
MOB1A-3381R | Recombinant Rat MOB1A Protein, His (Fc)-Avi-tagged | +Inquiry |
MOB1A-28177TH | Recombinant Human MOB1A, His-tagged | +Inquiry |
◆ Lysates | ||
MOB1A-413HCL | Recombinant Human MOB1A lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket