"MOB1A" Related Products

Expand
Expand
Expand

Recombinant Human MOB1A

Cat.No.: MOB1A-28178TH
Product Overview: Recombinant full length Human MOBK1B expressed in Saccharomyces cerevisiae; amino acids 1-216, 216 amino acids, MWt 25.1 kDa. Protein is tagged with 26 kDa proprietary tag.
Tissue specificity: Adrenal gland, bone marrow, brain, placenta, prostate, salivary gland, skeletal muscle, testis, thymus, thyroid gland, heart, spinal cord, fetal brain and fetal liver.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGN LRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEF CTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYID YLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLF RVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFN LIDRRELAPLQELIEKLGSKDR
Sequence Similarities: Belongs to the MOB1/phocein family.
Gene Name: MOB1A MOB kinase activator 1A [ Homo sapiens ]
Official Symbol: MOB1A
Synonyms: MOB1A; MOB kinase activator 1A; C2orf6, chromosome 2 open reading frame 6 , MOB1 Mps One Binder homolog A (yeast) , MOB1, Mps One Binder kinase activator like 1B (yeast) , MOBK1B, MOBKL1B; mps one binder kinase activator-like 1B; FLJ10788; FLJ11595; Ma
Gene ID: 55233
mRNA Refseq: NM_018221
Protein Refseq: NP_060691
MIM: 609281
Uniprot ID: Q9H8S9
Chromosome Location: 2p13.1
Function: metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.