"MORF4L2" Related Products

Expand
Expand

Recombinant Human MORF4L2, His-tagged

Cat.No.: MORF4L2-29353TH
Product Overview: Recombinant full length Human Mortality Factor 4 like 2 with an N terminal His tag; 308 amino acids with the tag, predicted MWt: 34.4 kDa.
Description: Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A.
Protein length: 288 amino acids
Conjugation: HIS
Molecular Weight: 34.400kDa
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Sequence Similarities: Belongs to the MRG family.
Gene Name: MORF4L2 mortality factor 4 like 2 [ Homo sapiens ]
Official Symbol: MORF4L2
Synonyms: MORF4L2; mortality factor 4 like 2; mortality factor 4-like protein 2; KIAA0026; MORF related gene X; MRGX;
Gene ID: 9643
mRNA Refseq: NM_001142425
Protein Refseq: NP_001135897
MIM: 300409
Uniprot ID: Q15014
Chromosome Location: Xq22
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.