"MOXD1" Related Products

Expand
Expand

Recombinant Human MOXD1, His-tagged

Cat.No.: MOXD1-29354TH
Product Overview: Recombinant fragment, corresponding to amino acids 53-417 of Human MOXD1 with N terminal His tag; MWt 42kDa.
Description: DBH-like monooxygenase protein 1, also known as monooxygenase X, is an enzyme that in humans is encoded by the MOXD1 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highly expressed in lung, kidney, brain and spinal cord.
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QVRTAGYVGFGFSPTGAMASADIVVGGVAHGRPYLQDYFT NANRELKKDAQQDYHLEYAMENSTHTIIEFTRELHTCD INDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKS LRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQ MFKIPVFQEKHHVIKVEPVIQRGHESLVHHILLYQCSNNF NDSVLESGHECYHPNMPDAFLTCETVIFAWAIGGEGFS YPPHVGLSLGTPLDPHYVLLEVHYDNPTYEEGLIDNSG LRLFYTMDIRKYDAGVIEAGLWVSLFHTIPPGMPEFQS EGHCTLECLEEALEAEKPSGIHVFAVLLHAHLAGRGIR LRHFRKGKEMKLLAYDDDF
Sequence Similarities: Belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 1 DOMON domain.
Gene Name: MOXD1 monooxygenase, DBH-like 1 [ Homo sapiens ]
Official Symbol: MOXD1
Synonyms: MOXD1; monooxygenase, DBH-like 1; DBH-like monooxygenase protein 1; dJ248E1.1; DKFZP564G202; MOX;
Gene ID: 26002
mRNA Refseq: NM_015529
Protein Refseq: NP_056344
MIM: 609000
Uniprot ID: Q6UVY6
Chromosome Location: 6q23.2
Function: copper ion binding; dopamine beta-monooxygenase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.