"MPP1" Related Products

Expand
Expand

Recombinant Human MPP1, His-tagged

Cat.No.: MPP1-29357TH
Product Overview: Recombinant fragment, corresponding to amino acids 32-466 of Human MPP1 with N terminal His tag; 435 amino acids, 56kDa.
Description: This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRL IQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQG SLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFA TGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQE WRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAFKRKTLVLIGASGVGRSHIKNALL SQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTR NISANEFLEFGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDS EAIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSP QWVPVSWVY
Sequence Similarities: Belongs to the MAGUK family.Contains 1 guanylate kinase-like domain.Contains 1 PDZ (DHR) domain.Contains 1 SH3 domain.
Gene Name: MPP1 membrane protein, palmitoylated 1, 55kDa [ Homo sapiens ]
Official Symbol: MPP1
Synonyms: MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP;
Gene ID: 4354
mRNA Refseq: NM_001166460
Protein Refseq: NP_001159932
MIM: 305360
Uniprot ID: Q00013
Chromosome Location: Xq28
Function: guanylate kinase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.