"MSRB2" Related Products

Expand
Expand
Expand

Recombinant Human MSRB2, His-tagged

Cat.No.: MSRB2-29914TH
Product Overview: Recombinant full length Human MSRB2 with an N terminal His tag; 183 amino acids with tag, MWt 19.5kDa.
Description: Methionine-R-sulfoxide reductase B2, mitochondrial is an enzyme that in humans is encoded by the MSRB2 gene.
Protein length: 162 amino acids
Conjugation: HIS
Molecular Weight: 19.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
Gene Name: MSRB2 methionine sulfoxide reductase B2 [ Homo sapiens ]
Official Symbol: MSRB2
Synonyms: MSRB2; methionine sulfoxide reductase B2; methionine sulfoxide reductase B , MSRB; methionine-R-sulfoxide reductase B2, mitochondrial; CBS 1; CBS1; CGI 131; PILB;
Gene ID: 22921
mRNA Refseq: NM_012228
Protein Refseq: NP_036360
MIM: 613782
Uniprot ID: Q9Y3D2
Chromosome Location: 10p12
Function: metal ion binding; oxidoreductase activity; peptide-methionine-(S)-S-oxide reductase activity; protein-methionine-R-oxide reductase activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.