"MT-ND1" Related Products

Recombinant Human MT-ND1

Cat.No.: MT-ND1-30257TH
Product Overview: Recombinant fragment of Human MT-ND1 with N terminal proprietary tag; Predicted MWt 31.24 kDa including the tag.
Protein length: 51 amino acids
Molecular Weight: 31.240kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY
Sequence Similarities: Belongs to the complex I subunit 1 family.
Gene Name: MT-ND1 mitochondrially encoded NADH dehydrogenase 1 [ Homo sapiens ]
Official Symbol: MT-ND1
Synonyms: MT-ND1; mitochondrially encoded NADH dehydrogenase 1; MTND1, NADH dehydrogenase 1; NADH dehydrogenase, subunit 1 (complex I); complex I ND1 subunit; NAD1; NADH ubiquinone oxidoreductase chain 1; ND1;
Gene ID: 4535
Uniprot ID: P03886
Chromosome Location: mitochondria
Pathway: Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem;
Function: NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.