"MT-ND4" Related Products

Recombinant Human MT-ND4

Cat.No.: MT-ND4-27840TH
Product Overview: Recombinant fragment of Human NADH dehydrogenase subunit 4 with N-terminal proprietary tag. Predicted MW 31.57kDa.
Protein length: 54 amino acids
Molecular Weight: 31.570kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
Sequence Similarities: Belongs to the complex I subunit 4 family.
Gene Name: MT-ND4 mitochondrially encoded NADH dehydrogenase 4 [ Homo sapiens ]
Official Symbol: MT-ND4
Synonyms: MT-ND4; mitochondrially encoded NADH dehydrogenase 4; MTND4, NADH dehydrogenase 4; NADH dehydrogenase, subunit 4 (complex I); complex I ND4 subunit; NAD4; NADH ubiquinone oxidoreductase chain 4; ND4;
Gene ID: 4538
Uniprot ID: P03905
Chromosome Location: mitochondria
Pathway: Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem;
Function: NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.