Recombinant Human MT-ND4

Cat.No. : MT-ND4-27840TH
Product Overview : Recombinant fragment of Human NADH dehydrogenase subunit 4 with N-terminal proprietary tag. Predicted MW 31.57kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 54 amino acids
Molecular Weight : 31.570kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
Sequence Similarities : Belongs to the complex I subunit 4 family.
Gene Name MT-ND4 mitochondrially encoded NADH dehydrogenase 4 [ Homo sapiens ]
Official Symbol MT-ND4
Synonyms MT-ND4; mitochondrially encoded NADH dehydrogenase 4; MTND4, NADH dehydrogenase 4; NADH dehydrogenase, subunit 4 (complex I); complex I ND4 subunit; NAD4; NADH ubiquinone oxidoreductase chain 4; ND4;
Gene ID 4538
Uniprot ID P03905
Chromosome Location mitochondria
Pathway Electron Transport Chain, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NAD/NADH phosphorylation and dephosphorylation, organism-specific biosystem; NADH:ubiquinone oxidoreductase, mitochondria, organism-specific biosystem;
Function NADH dehydrogenase (ubiquinone) activity; oxidoreductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT-ND4 Products

Required fields are marked with *

My Review for All MT-ND4 Products

Required fields are marked with *

0
cart-icon
0
compare icon