"MYF6" Related Products

Expand

Recombinant Human MYF6

Cat.No.: MYF6-29361TH
Product Overview: Recombinant fragment of Human MYF6 with N terminal proprietary tag, predicted mwt: 36.52 kDa.
Description: The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name: MYF6 myogenic factor 6 (herculin) [ Homo sapiens ]
Official Symbol: MYF6
Synonyms: MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4;
Gene ID: 4618
mRNA Refseq: NM_002469
Protein Refseq: NP_002460
MIM: 159991
Uniprot ID: P23409
Chromosome Location: 12q21
Pathway: C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem;
Function: DNA binding; contributes_to E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.