Recombinant Human MYF6
| Cat.No. : | MYF6-29361TH |
| Product Overview : | Recombinant fragment of Human MYF6 with N terminal proprietary tag, predicted mwt: 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAAT |
| Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Gene Name | MYF6 myogenic factor 6 (herculin) [ Homo sapiens ] |
| Official Symbol | MYF6 |
| Synonyms | MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; |
| Gene ID | 4618 |
| mRNA Refseq | NM_002469 |
| Protein Refseq | NP_002460 |
| MIM | 159991 |
| Uniprot ID | P23409 |
| Chromosome Location | 12q21 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; |
| Function | DNA binding; contributes_to E-box binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYF6 Products
Required fields are marked with *
My Review for All MYF6 Products
Required fields are marked with *




