"MYL12A" Related Products

Expand

Recombinant Human MYL12A, His-tagged

Cat.No.: MYL12A-28634TH
Product Overview: Recombinant full length Human MRCL3 (amino acids 1-171) with a N terminal His tag. 195 amino acids with a predicted MWt 22.4 kDa including tag.
Description: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
Protein length: 171 amino acids
Conjugation: HIS
Molecular Weight: 22.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQR ATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH DMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLN GTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDR FTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Sequence Similarities: Contains 3 EF-hand domains.
Gene Name: MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ]
Official Symbol: MYL12A
Synonyms: MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3;
Gene ID: 10627
mRNA Refseq: NM_006471
Protein Refseq: NP_006462
Uniprot ID: P19105
Chromosome Location: 18p11.31
Pathway: Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function: calcium ion binding; glutamate receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.