Recombinant Human MYL12A, His-tagged

• Cat.No.: MYL12A-28634TH
• Product Overview: Recombinant full length Human MRCL3 (amino acids 1-171) with a N terminal His tag. 195 amino acids with a predicted MWt 22.4 kDa including tag.

Specification

• Description: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
• Protein length: 171 amino acids
• Conjugation: HIS
• Molecular Weight: 22.400kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQR ATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH DMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLN GTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDR FTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Sequence Similarities: Contains 3 EF-hand domains.

Gene Information

• Gene Name: MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ]
• Official Symbol: MYL12A
• Synonyms: MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3
• Gene ID: 10627
• mRNA Refseq: NM_006471
• Protein Refseq: NP_006462
• Uniprot ID: P19105
• Chromosome Location: 18p11.31
• Pathway: Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Regulation of actin cytoskeleton, organism-specific biosystem
• Function: calcium ion binding; glutamate receptor binding