Recombinant Human MYL12A protein, GST-tagged

• Cat.No.: MYL12A-1814H
• Product Overview: Recombinant Human MYL12A protein(1-171 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-171 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ]
• Official Symbol: MYL12A
• Synonyms: MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3; MLC-2B; myosin RLC; myosin regulatory light chain MRCL3; myosin regulatory light chain MRLC3; myosin regulatory light chain 2, nonsarcomeric; myosin, light polypeptide, regulatory, non-sarcomeric (20kD)
• Gene ID: 10627
• mRNA Refseq: NM_006471
• Protein Refseq: NP_006462
• UniProt ID: P19105