"NAB2" Related Products

Recombinant Human NAB2

Cat.No.: NAB2-28773TH
Product Overview: Recombinant fragment of Human Nab2 (amino acids 421-525) with N terminal proprietary tag, 37.18 kDa.
Description: This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Protein length: 105 amino acids
Molecular Weight: 37.180kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed at low levels. Highly expressed in melanoma cell lines.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLM DEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCP APGPHPALVEGRRSSVKVEAEASRQ
Sequence Similarities: Belongs to the NAB family.
Gene Name: NAB2 NGFI-A binding protein 2 (EGR1 binding protein 2) [ Homo sapiens ]
Official Symbol: NAB2
Synonyms: NAB2; NGFI-A binding protein 2 (EGR1 binding protein 2); NGFI-A-binding protein 2; MADER;
Gene ID: 4665
mRNA Refseq: NM_005967
Protein Refseq: NP_005958
MIM: 602381
Uniprot ID: Q15742
Chromosome Location: 12q13.3
Function: transcription corepressor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.