Recombinant Human NAB2
Cat.No. : | NAB2-28773TH |
Product Overview : | Recombinant fragment of Human Nab2 (amino acids 421-525) with N terminal proprietary tag, 37.18 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
Protein length : | 105 amino acids |
Molecular Weight : | 37.180kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed at low levels. Highly expressed in melanoma cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLM DEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCP APGPHPALVEGRRSSVKVEAEASRQ |
Sequence Similarities : | Belongs to the NAB family. |
Gene Name : | NAB2 NGFI-A binding protein 2 (EGR1 binding protein 2) [ Homo sapiens ] |
Official Symbol : | NAB2 |
Synonyms : | NAB2; NGFI-A binding protein 2 (EGR1 binding protein 2); NGFI-A-binding protein 2; MADER; |
Gene ID : | 4665 |
mRNA Refseq : | NM_005967 |
Protein Refseq : | NP_005958 |
MIM : | 602381 |
Uniprot ID : | Q15742 |
Chromosome Location : | 12q13.3 |
Function : | transcription corepressor activity; transcription factor binding; |
Products Types
◆ Recombinant Protein | ||
Nab2-4275M | Recombinant Mouse Nab2 Protein, Myc/DDK-tagged | +Inquiry |
NAB2-2759R | Recombinant Rhesus Macaque NAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAB2-6425Z | Recombinant Zebrafish NAB2 | +Inquiry |
NAB2-2939R | Recombinant Rhesus monkey NAB2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
NAB2-3988HCL | Recombinant Human NAB2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket