"NANP" Related Products

Expand

Recombinant Human NANP, His-tagged

Cat.No.: NANP-28781TH
Product Overview: Recombinant full length Human NANP with an N terminal His tag; 284 amino acids with tag, MWt 31.9 kDa.
Description: NANP (N-acylneuraminate-9-phosphatase), also known as HDHD4 (Haloacid dehalogenase-like hydrolase domain-containing protein 4), is belongs to the haloacid dehalogenase (HAD) family and is responsible for dephosphorylating N-acylneuraminate 9-phosphate to
Protein length: 248 amino acids
Conjugation: HIS
Molecular Weight: 31.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Gene Name: NANP N-acetylneuraminic acid phosphatase [ Homo sapiens ]
Official Symbol: NANP
Synonyms: NANP; N-acetylneuraminic acid phosphatase; C20orf147, chromosome 20 open reading frame 147 , haloacid dehalogenase like hydrolase domain containing 4 , HDHD4; N-acylneuraminate-9-phosphatase; dJ694B14.3; MGC26833;
Gene ID: 140838
mRNA Refseq: NM_152667
Protein Refseq: NP_689880
MIM: 610763
Uniprot ID: Q8TBE9
Chromosome Location: 20p11.1
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem;
Function: N-acylneuraminate-9-phosphatase activity; hydrolase activity; phosphoglycolate phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.