"NANS" Related Products

Expand

Recombinant Human NANS

Cat.No.: NANS-28782TH
Product Overview: Recombinant full length Human NANS expressed in Saccharomyces cerevisiae; amino acids 1-359 , 40.3kDa.
Description: This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant.
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Immunogen affinity purified
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMI RMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWG KTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDE MAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMV ISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPED VNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGA KVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVE RALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILT MDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEE LVDNHGKKIKS
Sequence Similarities: Contains 1 AFP-like domain.
Gene Name: NANS N-acetylneuraminic acid synthase [ Homo sapiens ]
Official Symbol: NANS
Synonyms: NANS; N-acetylneuraminic acid synthase; sialic acid synthase; SAS;
Gene ID: 54187
mRNA Refseq: NM_018946
Protein Refseq: NP_061819
MIM: 605202
Uniprot ID: Q9NR45
Chromosome Location: 9p24.1-p23
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem;
Function: N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity; N-acylneuraminate-9-phosphate synthase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.