"NARF" Related Products

Expand

Recombinant Human NARF, His-tagged

Cat.No.: NARF-30280TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-322 of Human NARF Isoform 2 with an N terminal His tag; Predicted MWt 37 kDa.
Description: Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEF HKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFR VLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTD ASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRR YRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTA KSPQQVMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKK LEALQESLPPALHGSRGADCVLTSEISQAWWCTPVITA TREAAARESLEPGRQRLQRDKIAPLDSSLGGGGEIAQI MEQGDLSVRDAAVD
Gene Name: NARF nuclear prelamin A recognition factor [ Homo sapiens ]
Official Symbol: NARF
Synonyms: NARF; nuclear prelamin A recognition factor; DKFZp434G0420; FLJ10067; IOP2; iron only hydrogenase like protein 2;
Gene ID: 26502
mRNA Refseq: NM_001038618
Protein Refseq: NP_001033707
MIM: 605349
Uniprot ID: Q9UHQ1
Chromosome Location: 17q25.3
Function: lamin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.