Recombinant Human NARF, His-tagged
Cat.No. : | NARF-30280TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-322 of Human NARF Isoform 2 with an N terminal His tag; Predicted MWt 37 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-322 a.a. |
Description : | Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. The protein encoded by this gene binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. The encoded protein is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene, including one with a novel exon that is generated by RNA editing. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 125 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEF HKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFR VLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTD ASRRLCGFLKSLGVHYVFDTTIAADFSILESQKEFVRR YRQHSEEERTLPMLTSACPGWVRYAERVLGRPITAHLCTA KSPQQVMGSLVKDYFARQQNLSPEKIFHVIVAPCYDKK LEALQESLPPALHGSRGADCVLTSEISQAWWCTPVITA TREAAARESLEPGRQRLQRDKIAPLDSSLGGGGEIAQI MEQGDLSVRDAAVD |
Gene Name | NARF nuclear prelamin A recognition factor [ Homo sapiens ] |
Official Symbol | NARF |
Synonyms | NARF; nuclear prelamin A recognition factor; DKFZp434G0420; FLJ10067; IOP2; iron only hydrogenase like protein 2; |
Gene ID | 26502 |
mRNA Refseq | NM_001038618 |
Protein Refseq | NP_001033707 |
MIM | 605349 |
Uniprot ID | Q9UHQ1 |
Chromosome Location | 17q25.3 |
Function | lamin binding; |
◆ Recombinant Proteins | ||
Narf-1814R | Recombinant Rat Narf Protein, His-tagged | +Inquiry |
NARF-5910M | Recombinant Mouse NARF Protein, His (Fc)-Avi-tagged | +Inquiry |
NARF-4891H | Recombinant Human NARF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NARF-6610H | Recombinant Human NARF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NARF-10428M | Recombinant Mouse NARF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NARF-431HCL | Recombinant Human NARF lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NARF Products
Required fields are marked with *
My Review for All NARF Products
Required fields are marked with *
0
Inquiry Basket