Recombinant Human NCK2, His-tagged

• Cat.No.: NCK2-29113TH
• Product Overview: Recombinant fragment, corresponding to amino acids 199-380 of Human Nck beta with an N terminal His tag. Predicted mwt: 22 kDa:

Specification

• Description: This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Ubiquitous.
• Form: Lyophilised:Reconstitute with 82 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCK NARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSS SGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSE SSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDE LVEHYKKAPIFTSEHGEKLYLVRALQ
• Sequence Similarities: Contains 1 SH2 domain.Contains 3 SH3 domains.

Gene Information

• Gene Name: NCK2 NCK adaptor protein 2 [ Homo sapiens ]
• Official Symbol: NCK2
• Synonyms: NCK2; NCK adaptor protein 2; cytoplasmic protein NCK2; NCKbeta
• Gene ID: 8440
• mRNA Refseq: NM_001004720
• Protein Refseq: NP_001004720
• MIM: 604930
• Uniprot ID: O43639
• Chromosome Location: 2q12
• Pathway: Activation of Rac, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem
• Function: cytoskeletal adaptor activity; protein binding; receptor signaling complex scaffold activity