"NCL" Related Products

Expand
Expand
Expand

Recombinant Human NCL, His-tagged

Cat.No.: NCL-27593TH
Product Overview: Recombinant fragment, corresponding to amino acids 323-710 of Human Nucleolin with an N terminal His tag. Predicted MWt:43 kDa;
Description: Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilised. 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5.
AA Sequence: LKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDA RTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEI DGRSISLYYTGEKGQNQDYRGGKN STW SGESKTLVLSNLSYSATEETLQEVFEKATFIKV PQ NQNGKSKGYAFIEFASFE DAKEALNSCNKREIEGRAIR LELQGPRGSPNARSQPSKT LFVKGLSEDTTEET LKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMED G EIDGNKV TLDWAKPKGEGGFGGRGGGRGGFGGRGGGR GGRGGFGGRGRGGFGGRGGFRGG RGGGGDHKPQGKKTK FE
Applications: SDS-PAGE
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Reconstitution: Reconstitute with 105 µl aqua dest.
Gene Name: NCL nucleolin [ Homo sapiens (human) ]
Official Symbol: NCL
Synonyms: NCL; C23; nucleolin
Gene ID: 4691
mRNA Refseq: NM_005381
Protein Refseq: NP_005372
MIM: 164035
UniProt ID: P19338
Chromosome Location: 2q37.1
Pathway: Aurora B signaling; Pathogenic Escherichia coli infection; Regulation of Telomerase
Function: RNA binding; identical protein binding; protein C-terminus binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.